Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab5a [82399] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82400] (11 PDB entries) |
Domain d1tu4b_: 1tu4 B: [112650] |
PDB Entry: 1tu4 (more details), 2.2 Å
SCOP Domain Sequences for d1tu4b_:
Sequence, based on SEQRES records: (download)
>d1tu4b_ c.37.1.8 (B:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} icqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiwdta gqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkadl ankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp
>d1tu4b_ c.37.1.8 (B:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} icqfklvllgesavgksslvlrfvkgqfqestigaafltqtvclddttvkfeiwdtagqe ryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkadlank ravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp
Timeline for d1tu4b_: