Lineage for d1tu3e_ (1tu3 E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846547Protein Rab5a [82399] (1 species)
  7. 1846548Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
    Uniprot P20339 18-182
  8. 1846568Domain d1tu3e_: 1tu3 E: [112643]
    Other proteins in same PDB: d1tu3f_, d1tu3g_, d1tu3h_, d1tu3i_, d1tu3j_
    complexed with gnp, mg

Details for d1tu3e_

PDB Entry: 1tu3 (more details), 2.31 Å

PDB Description: Crystal Structure of Rab5 complex with Rabaptin5 C-terminal Domain
PDB Compounds: (E:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d1tu3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu3e_ c.37.1.8 (E:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
nkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiwd
tagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnka
dlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp

SCOPe Domain Coordinates for d1tu3e_:

Click to download the PDB-style file with coordinates for d1tu3e_.
(The format of our PDB-style files is described here.)

Timeline for d1tu3e_: