| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Rab5a [82399] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82400] (11 PDB entries) |
| Domain d1tu3c_: 1tu3 C: [112641] Other proteins in same PDB: d1tu3f_, d1tu3g_, d1tu3h_, d1tu3i_, d1tu3j_ |
PDB Entry: 1tu3 (more details), 2.31 Å
SCOP Domain Sequences for d1tu3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu3c_ c.37.1.8 (C:) Rab5a {Human (Homo sapiens)}
cqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiwdtag
qeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkadla
nkravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn
Timeline for d1tu3c_: