Lineage for d1tu3b_ (1tu3 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein Rab5a [82399] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
    Uniprot P20339 18-182
  8. Domain d1tu3b_: 1tu3 B: [112640]
    Other proteins in same PDB: d1tu3f_, d1tu3g_, d1tu3h_, d1tu3i_, d1tu3j_
    complexed with gnp, mg

Details for d1tu3b_

PDB Entry: 1tu3 (more details), 2.31 Å

PDB Description: Crystal Structure of Rab5 complex with Rabaptin5 C-terminal Domain
PDB Compounds: (B:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d1tu3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu3b_ c.37.1.8 (B:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
kicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiwdt
agqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkad
lankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp

SCOPe Domain Coordinates for d1tu3b_ are not available.

Timeline for d1tu3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tu3a_, d1tu3c_, d1tu3d_, d1tu3e_, d1tu3f_, d1tu3g_, d1tu3h_, d1tu3i_, d1tu3j_