Lineage for d1ttva_ (1ttv A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325522Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2325523Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2325524Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2325531Protein MDM2 [47594] (2 species)
  7. 2325532Species African clawed frog (Xenopus laevis) [TaxId:8355] [47595] (12 PDB entries)
    Uniprot P56273 13-119
  8. 2325548Domain d1ttva_: 1ttv A: [112637]
    complexed with imy

Details for d1ttva_

PDB Entry: 1ttv (more details)

PDB Description: nmr structure of a complex between mdm2 and a small molecule inhibitor
PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d1ttva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttva_ a.42.1.1 (A:) MDM2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
nhistsdqeklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivh
csndplgelfgvqefsvkehrriyamisrnlvsanvkessedifgnv

SCOPe Domain Coordinates for d1ttva_:

Click to download the PDB-style file with coordinates for d1ttva_.
(The format of our PDB-style files is described here.)

Timeline for d1ttva_: