Lineage for d1ttva_ (1ttv A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641571Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 641572Superfamily a.42.1: SWIB/MDM2 domain [47592] (1 family) (S)
    binds to the transactivation domain of human p53
  5. 641573Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam PF02201
  6. 641580Protein MDM2 [47594] (2 species)
  7. 641581Species African clawed frog (Xenopus laevis) [TaxId:8355] [47595] (2 PDB entries)
  8. 641583Domain d1ttva_: 1ttv A: [112637]
    complexed with imy; mutant

Details for d1ttva_

PDB Entry: 1ttv (more details)

PDB Description: nmr structure of a complex between mdm2 and a small molecule inhibitor
PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOP Domain Sequences for d1ttva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttva_ a.42.1.1 (A:) MDM2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
nhistsdqeklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivh
csndplgelfgvqefsvkehrriyamisrnlvsanvkessedifgnv

SCOP Domain Coordinates for d1ttva_:

Click to download the PDB-style file with coordinates for d1ttva_.
(The format of our PDB-style files is described here.)

Timeline for d1ttva_: