SCOPe 2.08: Domain d1tt7f1: 1tt7 F:2-127,F:295-330

Lineage for d1tt7f1 (1tt7 F:2-127,F:295-330)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.35: GroES-like [50128] (2 superfamilies)
contains barrel, partly opened; n*=4, S*=8; meander
Superfamily b.35.1: GroES-like [50129] (3 families)
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
C-terminal domain is alpha/beta (classical Rossmann-fold)
Protein Hypothetical protein YhfP [117171] (1 species)
Species Bacillus subtilis [TaxId:1423] [117172] (2 PDB entries)
Uniprot O07615
Domain d1tt7f1: 1tt7 F:2-127,F:295-330 [112633]
Other proteins in same PDB: d1tt7a2, d1tt7b2, d1tt7c2, d1tt7d2, d1tt7e2, d1tt7f2
Structural genomics target

Details for d1tt7f1

PDB Entry: 1tt7 (more details), 2.7 Å

PDB Description: crystal structure of bacillus subtilis protein yhfp

PDB Compounds: (F:) yhfp

SCOPe Domain Sequences for d1tt7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tt7f1 b.35.1.2 (F:2-127,F:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]}
stlfqalqaeknaddvsvhvktistedlpkdgvlikvaysginykdglagkaggnivrey
plilgidaagtvvssndprfaegdeviatsyelgvsrdgglseyasvpgdwlvplpqnls
lkeamvXdqlltivdrevsleetpgalkdilqnriqgrvivkl

SCOPe Domain Coordinates for d1tt7f1:

Click to download the PDB-style file with coordinates for d1tt7f1.
(The format of our PDB-style files is described here.)

Timeline for d1tt7f1: