Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
Protein Hypothetical protein YhfP [117405] (1 species) |
Species Bacillus subtilis [TaxId:1423] [117406] (2 PDB entries) Uniprot O07615 |
Domain d1tt7e2: 1tt7 E:128-294 [112632] Other proteins in same PDB: d1tt7a1, d1tt7b1, d1tt7c1, d1tt7d1, d1tt7e1, d1tt7f1 Structural genomics target |
PDB Entry: 1tt7 (more details), 2.7 Å
SCOPe Domain Sequences for d1tt7e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tt7e2 c.2.1.1 (E:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} ygtagftaalsvhrleqnglspekgsvlvtgatggvggiavsmlnkrgydvvastgnrea adylkqlgasevisredvydgtlkalskqqwqgavdpvggkqlasllskiqyggsvavsg ltgggevpatvypfilrgvsllgidsvycpmdvraavwermssdlkp
Timeline for d1tt7e2: