Lineage for d1tt7a1 (1tt7 A:2-127,A:295-330)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2055849Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2055850Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2055978Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2056262Protein Hypothetical protein YhfP [117171] (1 species)
  7. 2056263Species Bacillus subtilis [TaxId:1423] [117172] (2 PDB entries)
    Uniprot O07615
  8. 2056264Domain d1tt7a1: 1tt7 A:2-127,A:295-330 [112623]
    Other proteins in same PDB: d1tt7a2, d1tt7b2, d1tt7c2, d1tt7d2, d1tt7e2, d1tt7f2
    Structural genomics target

Details for d1tt7a1

PDB Entry: 1tt7 (more details), 2.7 Å

PDB Description: crystal structure of bacillus subtilis protein yhfp
PDB Compounds: (A:) yhfp

SCOPe Domain Sequences for d1tt7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]}
stlfqalqaeknaddvsvhvktistedlpkdgvlikvaysginykdglagkaggnivrey
plilgidaagtvvssndprfaegdeviatsyelgvsrdgglseyasvpgdwlvplpqnls
lkeamvXdqlltivdrevsleetpgalkdilqnriqgrvivkl

SCOPe Domain Coordinates for d1tt7a1:

Click to download the PDB-style file with coordinates for d1tt7a1.
(The format of our PDB-style files is described here.)

Timeline for d1tt7a1: