Lineage for d1tt6a_ (1tt6 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552997Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 553127Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) (S)
  5. 553128Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)
  6. 553129Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 553150Species Human (Homo sapiens) [TaxId:9606] [49475] (50 PDB entries)
  8. 553173Domain d1tt6a_: 1tt6 A: [112621]

Details for d1tt6a_

PDB Entry: 1tt6 (more details), 1.8 Å

PDB Description: the orthorhombic crystal structure of transthyretin in complex with diethylstilbestrol

SCOP Domain Sequences for d1tt6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tt6a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOP Domain Coordinates for d1tt6a_:

Click to download the PDB-style file with coordinates for d1tt6a_.
(The format of our PDB-style files is described here.)

Timeline for d1tt6a_: