![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins) Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping) |
![]() | Protein Hypothetical protein MW1090 [117872] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [117873] (1 PDB entry) Uniprot Q8NX24 |
![]() | Domain d1tsja_: 1tsj A: [112620] Structural genomics target |
PDB Entry: 1tsj (more details), 2.6 Å
SCOPe Domain Sequences for d1tsja_:
Sequence, based on SEQRES records: (download)
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} mdipkittflmfnnqaeeavklytslfedseiitmakygengpgdpgtvqhsiftlngqv fmaidansgtelpislfvtvkdtiemerlfnglkdegailmpktnmppyrefawvqdkfg vsfqlalpe
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} mdipkittflmfnnqaeeavklytslfedseiitmakygdpgtvqhsiftlngqvfmaid pislfvtvkdtiemerlfnglkdegailmpktnmppyrefawvqdkfgvsfqlalpe
Timeline for d1tsja_: