Lineage for d1tsja_ (1tsj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942843Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
    Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping)
  6. 2942844Protein Hypothetical protein MW1090 [117872] (1 species)
  7. 2942845Species Staphylococcus aureus [TaxId:1280] [117873] (1 PDB entry)
    Uniprot Q8NX24
  8. 2942846Domain d1tsja_: 1tsj A: [112620]
    Structural genomics target

Details for d1tsja_

PDB Entry: 1tsj (more details), 2.6 Å

PDB Description: crystal structure of protein from staphylococcus aureus
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1tsja_:

Sequence, based on SEQRES records: (download)

>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]}
mdipkittflmfnnqaeeavklytslfedseiitmakygengpgdpgtvqhsiftlngqv
fmaidansgtelpislfvtvkdtiemerlfnglkdegailmpktnmppyrefawvqdkfg
vsfqlalpe

Sequence, based on observed residues (ATOM records): (download)

>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]}
mdipkittflmfnnqaeeavklytslfedseiitmakygdpgtvqhsiftlngqvfmaid
pislfvtvkdtiemerlfnglkdegailmpktnmppyrefawvqdkfgvsfqlalpe

SCOPe Domain Coordinates for d1tsja_:

Click to download the PDB-style file with coordinates for d1tsja_.
(The format of our PDB-style files is described here.)

Timeline for d1tsja_: