Lineage for d1tsfa_ (1tsf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824692Fold b.137: Rof/RNase P subunit-like [101743] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 2824693Superfamily b.137.1: Rof/RNase P subunit-like [101744] (2 families) (S)
  5. 2824694Family b.137.1.1: RNase P subunit p29-like [101745] (3 proteins)
    two available NMR structures display similar topologies but different barrel shapes
    the barrel shape of the full-length X-ray structures of AF1917 differs from both earlier NMR structures
    automatically mapped to Pfam PF01868
  6. 2824695Protein Hypothetical protein AF1917 [101746] (1 species)
  7. 2824696Species Archaeoglobus fulgidus [TaxId:2234] [101747] (3 PDB entries)
    Uniprot O28362
  8. 2824698Domain d1tsfa_: 1tsf A: [112619]

Details for d1tsfa_

PDB Entry: 1tsf (more details), 1.7 Å

PDB Description: Crystal Structure of the Archaeal homolog of Human RNase P Protein Rpp29 from Archaeoglobus fulgidus
PDB Compounds: (A:) Ribonuclease P protein component 1

SCOPe Domain Sequences for d1tsfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tsfa_ b.137.1.1 (A:) Hypothetical protein AF1917 {Archaeoglobus fulgidus [TaxId: 2234]}
qgveliardwiglmvevvespnhsevgikgevvdetqntlkimtekglkvvakrgrtfrv
wykgkimrikgdlinfrpedr

SCOPe Domain Coordinates for d1tsfa_:

Click to download the PDB-style file with coordinates for d1tsfa_.
(The format of our PDB-style files is described here.)

Timeline for d1tsfa_: