![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.137: Rof/RNase P subunit-like [101743] (1 superfamily) core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold |
![]() | Superfamily b.137.1: Rof/RNase P subunit-like [101744] (2 families) ![]() |
![]() | Family b.137.1.1: RNase P subunit p29-like [101745] (3 proteins) two available NMR structures display similar topologies but different barrel shapes the barrel shape of the full-length X-ray structures of AF1917 differs from both earlier NMR structures automatically mapped to Pfam PF01868 |
![]() | Protein Hypothetical protein AF1917 [101746] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [101747] (3 PDB entries) Uniprot O28362 |
![]() | Domain d1tsfa_: 1tsf A: [112619] |
PDB Entry: 1tsf (more details), 1.7 Å
SCOPe Domain Sequences for d1tsfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tsfa_ b.137.1.1 (A:) Hypothetical protein AF1917 {Archaeoglobus fulgidus [TaxId: 2234]} qgveliardwiglmvevvespnhsevgikgevvdetqntlkimtekglkvvakrgrtfrv wykgkimrikgdlinfrpedr
Timeline for d1tsfa_: