SCOPe 2.08: Domain d1ts9a_: 1ts9 A:

Lineage for d1ts9a_ (1ts9 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.137: Rof/RNase P subunit-like [101743] (1 superfamily)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold

4. Superfamily b.137.1: Rof/RNase P subunit-like [101744] (2 families)

5. Family b.137.1.1: RNase P subunit p29-like [101745] (3 proteins)
   two available NMR structures display similar topologies but different barrel shapes
   the barrel shape of the full-length X-ray structures of AF1917 differs from both earlier NMR structures
   automatically mapped to Pfam PF01868

6. Protein Hypothetical protein AF1917 [101746] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [101747] (3 PDB entries)
   Uniprot O28362

8. Domain d1ts9a_: 1ts9 A: [112618]

Details for d1ts9a_

PDB Entry: 1ts9, 1.7 Å

PDB Description: Crystal Structure of the Archaeal Homolog of Human RNase P Protein Rpp29 from Archaeoglobus fulgidus

PDB Compounds: (A:) Ribonuclease P protein component 1

SCOPe Domain Sequences for d1ts9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ts9a_ b.137.1.1 (A:) Hypothetical protein AF1917 {Archaeoglobus fulgidus [TaxId: 2234]}
lqgveliardwiglmvevvespnhsevgikgevvdetqntlkimtekglkvvakrgrtfr
vwykgkimrikgdlinfrpedrikrglmmlkrakgvwi

Timeline for d1ts9a_:

• d1ts9a_ first appeared in SCOP 1.71
  
• d1ts9a_ appears in SCOPe 2.07