Lineage for d1tr4a_ (1tr4 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944478Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1944479Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1944480Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 1944481Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (3 species)
  7. 1944484Species Human (Homo sapiens) [TaxId:9606] [102882] (3 PDB entries)
    Uniprot O75832
  8. 1944487Domain d1tr4a_: 1tr4 A: [112616]

Details for d1tr4a_

PDB Entry: 1tr4 (more details)

PDB Description: solution structure of human oncogenic protein gankyrin
PDB Compounds: (A:) 26S proteasome non-ATPase regulatory subunit 10

SCOPe Domain Sequences for d1tr4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tr4a_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]}
megcvsnlmvcnlaysgkleelkesiladkslatrtdqdsrtalhwacsaghteivefll
qlgvpvndkddagwsplhiaasagrdeivkallgkgaqvnavnqngctplhyaasknrhe
iavmllegganpdakdhyeatamhraaakgnlkmihillyykastniqdtegntplhlac
deerveeakllvsqgasiyienkeektplqvakgglglilkrmveg

SCOPe Domain Coordinates for d1tr4a_:

Click to download the PDB-style file with coordinates for d1tr4a_.
(The format of our PDB-style files is described here.)

Timeline for d1tr4a_: