Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (19 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [102882] (3 PDB entries) Uniprot O75832 |
Domain d1tr4a_: 1tr4 A: [112616] |
PDB Entry: 1tr4 (more details)
SCOPe Domain Sequences for d1tr4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tr4a_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} megcvsnlmvcnlaysgkleelkesiladkslatrtdqdsrtalhwacsaghteivefll qlgvpvndkddagwsplhiaasagrdeivkallgkgaqvnavnqngctplhyaasknrhe iavmllegganpdakdhyeatamhraaakgnlkmihillyykastniqdtegntplhlac deerveeakllvsqgasiyienkeektplqvakgglglilkrmveg
Timeline for d1tr4a_: