![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families) ![]() |
![]() | Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein) |
![]() | Protein D-ribulose-5-phosphate 3-epimerase [51373] (4 species) |
![]() | Species Plasmodium falciparum [117359] (1 PDB entry) |
![]() | Domain d1tqxb_: 1tqx B: [112615] Structural genomics target complexed with so4, zn |
PDB Entry: 1tqx (more details), 2 Å
SCOP Domain Sequences for d1tqxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqxb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum} lkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkkytk siffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikp ktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdggln ietteisashganiivagtsifnaedpkyvidtmrvsvqky
Timeline for d1tqxb_: