Lineage for d1tqxb_ (1tqx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826748Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (2 proteins)
    automatically mapped to Pfam PF00834
  6. 2826749Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)
  7. 2826750Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [117359] (1 PDB entry)
    Uniprot Q8I5L3
  8. 2826752Domain d1tqxb_: 1tqx B: [112615]
    Structural genomics target
    complexed with so4, zn

Details for d1tqxb_

PDB Entry: 1tqx (more details), 2 Å

PDB Description: Crystal Structure of Pfal009167 A Putative D-Ribulose 5-Phosphate 3-Epimerase from P.falciparum
PDB Compounds: (B:) D-ribulose-5-phosphate 3-epimerase, putative

SCOPe Domain Sequences for d1tqxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqxb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
lkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkkytk
siffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikp
ktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdggln
ietteisashganiivagtsifnaedpkyvidtmrvsvqky

SCOPe Domain Coordinates for d1tqxb_:

Click to download the PDB-style file with coordinates for d1tqxb_.
(The format of our PDB-style files is described here.)

Timeline for d1tqxb_: