Lineage for d1tqxa_ (1tqx A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2090346Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)
    automatically mapped to Pfam PF00834
  6. 2090347Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)
  7. 2090348Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [117359] (1 PDB entry)
    Uniprot Q8I5L3
  8. 2090349Domain d1tqxa_: 1tqx A: [112614]
    Structural genomics target
    complexed with so4, zn

Details for d1tqxa_

PDB Entry: 1tqx (more details), 2 Å

PDB Description: Crystal Structure of Pfal009167 A Putative D-Ribulose 5-Phosphate 3-Epimerase from P.falciparum
PDB Compounds: (A:) D-ribulose-5-phosphate 3-epimerase, putative

SCOPe Domain Sequences for d1tqxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
lkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkkytk
siffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikp
ktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdggln
ietteisashganiivagtsifnaedpkyvidtmrvsvqky

SCOPe Domain Coordinates for d1tqxa_:

Click to download the PDB-style file with coordinates for d1tqxa_.
(The format of our PDB-style files is described here.)

Timeline for d1tqxa_: