SCOP 1.75: Domain d1tqxa_: 1tqx A:

Lineage for d1tqxa_ (1tqx A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)

6. Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)

7. Species Plasmodium falciparum [TaxId:5833] [117359] (1 PDB entry)
   Uniprot Q8I5L3

8. Domain d1tqxa_: 1tqx A: [112614]
   Structural genomics target

Details for d1tqxa_

PDB Entry: 1tqx, 2 Å

PDB Description: Crystal Structure of Pfal009167 A Putative D-Ribulose 5-Phosphate 3-Epimerase from P.falciparum

PDB Compounds: (A:) D-ribulose-5-phosphate 3-epimerase, putative

SCOP Domain Sequences for d1tqxa_:

Sequence; same for both SEQRES and ATOM records:

>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]}
lkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkkytk
siffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikp
ktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdggln
ietteisashganiivagtsifnaedpkyvidtmrvsvqky

Timeline for d1tqxa_:

• d1tqxa_ first appeared in SCOP 1.71
  
• d1tqxa_ appears in SCOP 1.73
  
• d1tqxa_ appears in SCOPe 2.01
  
• d1tqxa_ appears in the current release, SCOPe 2.08