Lineage for d1tqxa_ (1tqx A:)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families) 
Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein) Protein D-ribulose-5-phosphate 3-epimerase [51373] (4 species) 
Species Plasmodium falciparum [117359] (1 PDB entry) 
Domain d1tqxa_: 1tqx A: [112614]
Details for d1tqxa_
PDB Entry: 1tqx (more details), 2 Å
PDB Description: Crystal Structure of Pfal009167 A Putative D-Ribulose 5-Phosphate 3-Epimerase from P.falciparum
SCOP Domain Sequences for d1tqxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum}
lkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkkytk
siffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikp
ktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdggln
ietteisashganiivagtsifnaedpkyvidtmrvsvqky
SCOP Domain Coordinates for d1tqxa_:
Click to download the PDB-style file with coordinates for d1tqxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tqxa_:
- d1tqxa_ is new in SCOP 1.71
- d1tqxa_ appears in SCOP 1.73
- d1tqxa_ appears in the current release, SCOPe 2.08
View in 3D
