Lineage for d1tqxa_ (1tqx A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570417Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families) (S)
  5. 570444Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)
  6. 570445Protein D-ribulose-5-phosphate 3-epimerase [51373] (4 species)
  7. 570446Species Plasmodium falciparum [117359] (1 PDB entry)
  8. 570447Domain d1tqxa_: 1tqx A: [112614]

Details for d1tqxa_

PDB Entry: 1tqx (more details), 2 Å

PDB Description: Crystal Structure of Pfal009167 A Putative D-Ribulose 5-Phosphate 3-Epimerase from P.falciparum

SCOP Domain Sequences for d1tqxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum}
lkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkkytk
siffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikp
ktdvqklvpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdggln
ietteisashganiivagtsifnaedpkyvidtmrvsvqky

SCOP Domain Coordinates for d1tqxa_:

Click to download the PDB-style file with coordinates for d1tqxa_.
(The format of our PDB-style files is described here.)

Timeline for d1tqxa_: