Lineage for d1tqfa_ (1tqf A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562942Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 562943Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 563392Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 563447Protein beta-secretase (memapsin) [50671] (1 species)
  7. 563448Species Human (Homo sapiens) [TaxId:9606] [50672] (7 PDB entries)
  8. 563451Domain d1tqfa_: 1tqf A: [112613]
    complexed with 32p; mutant

Details for d1tqfa_

PDB Entry: 1tqf (more details), 1.8 Å

PDB Description: Crystal structure of human Beta secretase complexed with inhibitor
PDB Compounds: (A:)

SCOP Domain Sequences for d1tqfa_:

Sequence, based on SEQRES records: (download)

>d1tqfa_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens)}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgawagelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d1tqfa_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens)}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgawagelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgaggsmiiggidhslytgslw
ytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksik
aasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrpv
eqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegpf
vtldmedcgyn

SCOP Domain Coordinates for d1tqfa_:

Click to download the PDB-style file with coordinates for d1tqfa_.
(The format of our PDB-style files is described here.)

Timeline for d1tqfa_: