Lineage for d1tqeq_ (1tqe Q:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728884Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 728885Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 728886Family d.88.1.1: SRF-like [55456] (4 proteins)
  6. 728899Protein Myocyte enhancer factor Mef2b core [103117] (1 species)
  7. 728900Species Human (Homo sapiens) [TaxId:9606] [103118] (2 PDB entries)
  8. 728904Domain d1tqeq_: 1tqe Q: [112610]

Details for d1tqeq_

PDB Entry: 1tqe (more details), 2.7 Å

PDB Description: mechanism of recruitment of class ii histone deacetylases by myocyte enhancer factor-2
PDB Compounds: (Q:) Myocyte-specific enhancer factor 2B

SCOP Domain Sequences for d1tqeq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqeq_ d.88.1.1 (Q:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
mdrvllkyteysephesrtntdiletlkrr

SCOP Domain Coordinates for d1tqeq_:

Click to download the PDB-style file with coordinates for d1tqeq_.
(The format of our PDB-style files is described here.)

Timeline for d1tqeq_: