Lineage for d1tokb_ (1tok B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2502822Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2502882Protein Aspartate aminotransferase, AAT [53385] (9 species)
  7. 2502917Species Escherichia coli [TaxId:562] [53390] (84 PDB entries)
    Uniprot P00509
  8. 2502931Domain d1tokb_: 1tok B: [112603]
    complexed with mae; mutant

Details for d1tokb_

PDB Entry: 1tok (more details), 1.85 Å

PDB Description: maleic acid-bound structure of srhept mutant of e. coli aspartate aminotransferase
PDB Compounds: (B:) aspartate aminotransferase

SCOPe Domain Sequences for d1tokb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tokb_ c.67.1.1 (B:) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]}
mfenitattadpilgladlfraderpgkidlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfalynervgactlvaadsetvdrafgqmkaairanyssppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOPe Domain Coordinates for d1tokb_:

Click to download the PDB-style file with coordinates for d1tokb_.
(The format of our PDB-style files is described here.)

Timeline for d1tokb_: