Lineage for d1toja_ (1toj A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 705387Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 705422Species Escherichia coli [TaxId:562] [53390] (60 PDB entries)
  8. 705424Domain d1toja_: 1toj A: [112601]
    complexed with hci; mutant

Details for d1toja_

PDB Entry: 1toj (more details), 1.9 Å

PDB Description: Hydrocinnamic acid-bound structure of SRHEPT mutant of E. coli aspartate aminotransferase
PDB Compounds: (A:) aspartate aminotransferase

SCOP Domain Sequences for d1toja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1toja_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]}
mfenitattadpilgladlfraderpgkidlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfalynervgactlvaadsetvdrafgqmkaairanyssppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOP Domain Coordinates for d1toja_:

Click to download the PDB-style file with coordinates for d1toja_.
(The format of our PDB-style files is described here.)

Timeline for d1toja_: