SCOPe 2.01: Domain d1to2i_: 1to2 I:

Lineage for d1to2i_ (1to2 I:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)

6. Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
   Uniprot Q40059 22-84

8. Domain d1to2i_: 1to2 I: [112596]
   Other proteins in same PDB: d1to2e_
   complexed with 15p, ca, cit, na

Details for d1to2i_

PDB Entry: 1to2, 1.3 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59k, in ph 9 cryosoak

PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1to2i_:

Sequence; same for both SEQRES and ATOM records:

>d1to2i_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
mktewpelvgksveeakkvilqdkpaaqiivlpvgtivtkeyridrvrlfvdrldniaqv
prvg

Timeline for d1to2i_:

• d1to2i_ first appeared in SCOP 1.71
  
• d1to2i_ appears in SCOP 1.75
  
• d1to2i_ appears in SCOPe 2.02
  
• d1to2i_ appears in the current release, SCOPe 2.08