Class a: All alpha proteins [46456] (286 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries) Uniprot Q02293 22-418 P53610 |
Domain d1tnzl_: 1tnz L: [112592] Other proteins in same PDB: d1tnza_, d1tnzc_, d1tnze_, d1tnzg_, d1tnzi_, d1tnzk_ complexed with cl, mes, mgm, zn |
PDB Entry: 1tnz (more details), 2.9 Å
SCOPe Domain Sequences for d1tnzl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tnzl_ a.102.4.3 (L:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]} ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
Timeline for d1tnzl_: