Lineage for d1tnzl_ (1tnz L:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541757Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 541951Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 542076Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 542077Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 542078Species Human (Homo sapiens) [TaxId:9606] [69090] (14 PDB entries)
  8. 542117Domain d1tnzl_: 1tnz L: [112592]
    Other proteins in same PDB: d1tnza_, d1tnzc_, d1tnze_, d1tnzg_, d1tnzi_, d1tnzk_
    complexed with cl, mes, mgm, zn

Details for d1tnzl_

PDB Entry: 1tnz (more details), 2.9 Å

PDB Description: Rat Protein Geranylgeranyltransferase Type-I Complexed with a GGPP analog and a RRCVLL Peptide Derived from Cdc42 splice isoform-2

SCOP Domain Sequences for d1tnzl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnzl_ a.102.4.3 (L:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens)}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOP Domain Coordinates for d1tnzl_:

Click to download the PDB-style file with coordinates for d1tnzl_.
(The format of our PDB-style files is described here.)

Timeline for d1tnzl_: