Lineage for d1tnzi_ (1tnz I:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 542934Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 542935Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 542936Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 542937Species Human (Homo sapiens) [TaxId:9606] [69093] (14 PDB entries)
  8. 542975Domain d1tnzi_: 1tnz I: [112589]
    Other proteins in same PDB: d1tnzb_, d1tnzd_, d1tnzf_, d1tnzh_, d1tnzj_, d1tnzl_

Details for d1tnzi_

PDB Entry: 1tnz (more details), 2.9 Å

PDB Description: Rat Protein Geranylgeranyltransferase Type-I Complexed with a GGPP analog and a RRCVLL Peptide Derived from Cdc42 splice isoform-2

SCOP Domain Sequences for d1tnzi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnzi_ a.118.6.1 (I:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens)}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOP Domain Coordinates for d1tnzi_:

Click to download the PDB-style file with coordinates for d1tnzi_.
(The format of our PDB-style files is described here.)

Timeline for d1tnzi_: