Lineage for d1tnzc_ (1tnz C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726312Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2726313Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2726314Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2726329Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 2726387Domain d1tnzc_: 1tnz C: [112583]
    Other proteins in same PDB: d1tnzb_, d1tnzd_, d1tnzf_, d1tnzh_, d1tnzj_, d1tnzl_
    complexed with cl, mes, mgm, zn

Details for d1tnzc_

PDB Entry: 1tnz (more details), 2.9 Å

PDB Description: Rat Protein Geranylgeranyltransferase Type-I Complexed with a GGPP analog and a RRCVLL Peptide Derived from Cdc42 splice isoform-2
PDB Compounds: (C:) geranylgeranyltransferase type I alpha subunit

SCOPe Domain Sequences for d1tnzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnzc_ a.118.6.1 (C:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOPe Domain Coordinates for d1tnzc_:

Click to download the PDB-style file with coordinates for d1tnzc_.
(The format of our PDB-style files is described here.)

Timeline for d1tnzc_: