Lineage for d1tnyk_ (1tny K:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339381Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2339382Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2339383Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2339398Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 2339435Domain d1tnyk_: 1tny K: [112579]
    Other proteins in same PDB: d1tnyb_, d1tnyd_, d1tnyf_, d1tnyh_, d1tnyj_, d1tnyl_
    complexed with cl, mes, mgm, zn

Details for d1tnyk_

PDB Entry: 1tny (more details), 2.7 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a frekkffcail peptide derived from the heterotrimeric g protein gamma-2 subunit
PDB Compounds: (K:) geranylgeranyltransferase type I alpha subunit

SCOPe Domain Sequences for d1tnyk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnyk_ a.118.6.1 (K:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOPe Domain Coordinates for d1tnyk_:

Click to download the PDB-style file with coordinates for d1tnyk_.
(The format of our PDB-style files is described here.)

Timeline for d1tnyk_: