Lineage for d1tnyf_ (1tny F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722636Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2722637Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2722652Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 2722685Domain d1tnyf_: 1tny F: [112574]
    Other proteins in same PDB: d1tnya_, d1tnyc_, d1tnye_, d1tnyg_, d1tnyi_, d1tnyk_
    complexed with cl, mes, mgm, zn

Details for d1tnyf_

PDB Entry: 1tny (more details), 2.7 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a frekkffcail peptide derived from the heterotrimeric g protein gamma-2 subunit
PDB Compounds: (F:) Geranylgeranyl transferase type I beta subunit

SCOPe Domain Sequences for d1tnyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnyf_ a.102.4.3 (F:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOPe Domain Coordinates for d1tnyf_:

Click to download the PDB-style file with coordinates for d1tnyf_.
(The format of our PDB-style files is described here.)

Timeline for d1tnyf_: