Lineage for d1tnub_ (1tnu B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 646026Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 646151Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 646152Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 646153Species Human (Homo sapiens) [TaxId:9606] [69090] (17 PDB entries)
  8. 646190Domain d1tnub_: 1tnu B: [112558]
    Other proteins in same PDB: d1tnua_, d1tnuc_, d1tnue_, d1tnug_, d1tnui_, d1tnuk_

Details for d1tnub_

PDB Entry: 1tnu (more details), 2.7 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a gcincckvl peptide derived from rhob
PDB Compounds: (B:) Geranylgeranyl transferase type I beta subunit

SCOP Domain Sequences for d1tnub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnub_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOP Domain Coordinates for d1tnub_:

Click to download the PDB-style file with coordinates for d1tnub_.
(The format of our PDB-style files is described here.)

Timeline for d1tnub_: