Lineage for d1tnoi_ (1tno I:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922275Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 922276Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 922277Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 922278Species Human (Homo sapiens) [TaxId:9606] [69093] (20 PDB entries)
    Uniprot P49354
  8. 922302Domain d1tnoi_: 1tno I: [112553]
    Other proteins in same PDB: d1tnob_, d1tnod_, d1tnof_, d1tnoh_, d1tnoj_, d1tnol_
    complexed with cl, mes, mgm, zn

Details for d1tnoi_

PDB Entry: 1tno (more details), 2.7 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvim peptide derived from k-ras4b
PDB Compounds: (I:) geranylgeranyltransferase type I alpha subunit

SCOPe Domain Sequences for d1tnoi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnoi_ a.118.6.1 (I:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOPe Domain Coordinates for d1tnoi_:

Click to download the PDB-style file with coordinates for d1tnoi_.
(The format of our PDB-style files is described here.)

Timeline for d1tnoi_: