Lineage for d1tnoh_ (1tno H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004554Family a.102.4.3: Protein prenyltransferases [48246] (3 protein domains)
  6. 2004555Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2004570Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 2004628Domain d1tnoh_: 1tno H: [112552]
    Other proteins in same PDB: d1tnoa_, d1tnoc_, d1tnoe_, d1tnog_, d1tnoi_, d1tnok_
    complexed with cl, mes, mgm, zn

Details for d1tnoh_

PDB Entry: 1tno (more details), 2.7 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvim peptide derived from k-ras4b
PDB Compounds: (H:) Geranylgeranyl transferase type I beta subunit

SCOPe Domain Sequences for d1tnoh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnoh_ a.102.4.3 (H:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOPe Domain Coordinates for d1tnoh_:

Click to download the PDB-style file with coordinates for d1tnoh_.
(The format of our PDB-style files is described here.)

Timeline for d1tnoh_: