Lineage for d1tnoc_ (1tno C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726312Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2726313Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2726314Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2726329Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 2726368Domain d1tnoc_: 1tno C: [112547]
    Other proteins in same PDB: d1tnob_, d1tnod_, d1tnof_, d1tnoh_, d1tnoj_, d1tnol_
    complexed with cl, mes, mgm, zn

Details for d1tnoc_

PDB Entry: 1tno (more details), 2.7 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvim peptide derived from k-ras4b
PDB Compounds: (C:) geranylgeranyltransferase type I alpha subunit

SCOPe Domain Sequences for d1tnoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnoc_ a.118.6.1 (C:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOPe Domain Coordinates for d1tnoc_:

Click to download the PDB-style file with coordinates for d1tnoc_.
(The format of our PDB-style files is described here.)

Timeline for d1tnoc_: