Lineage for d1tnbe_ (1tnb E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647144Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 647145Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 647146Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 647147Species Human (Homo sapiens) [TaxId:9606] [69093] (20 PDB entries)
  8. 647175Domain d1tnbe_: 1tnb E: [112537]
    Other proteins in same PDB: d1tnbb_, d1tnbd_, d1tnbf_, d1tnbh_, d1tnbj_, d1tnbl_

Details for d1tnbe_

PDB Entry: 1tnb (more details), 2.85 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a substrate kksktkcvif peptide derived from tc21
PDB Compounds: (E:) geranylgeranyltransferase type I alpha subunit

SCOP Domain Sequences for d1tnbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnbe_ a.118.6.1 (E:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOP Domain Coordinates for d1tnbe_:

Click to download the PDB-style file with coordinates for d1tnbe_.
(The format of our PDB-style files is described here.)

Timeline for d1tnbe_: