Lineage for d1tnbd_ (1tnb D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541757Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 541951Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 542076Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 542077Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 542078Species Human (Homo sapiens) [TaxId:9606] [69090] (14 PDB entries)
  8. 542107Domain d1tnbd_: 1tnb D: [112536]
    Other proteins in same PDB: d1tnba_, d1tnbc_, d1tnbe_, d1tnbg_, d1tnbi_, d1tnbk_

Details for d1tnbd_

PDB Entry: 1tnb (more details), 2.85 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a substrate kksktkcvif peptide derived from tc21

SCOP Domain Sequences for d1tnbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnbd_ a.102.4.3 (D:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens)}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOP Domain Coordinates for d1tnbd_:

Click to download the PDB-style file with coordinates for d1tnbd_.
(The format of our PDB-style files is described here.)

Timeline for d1tnbd_: