Lineage for d1tnbd_ (1tnb D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. Domain d1tnbd_: 1tnb D: [112536]
    Other proteins in same PDB: d1tnba_, d1tnbc_, d1tnbe_, d1tnbg_, d1tnbi_, d1tnbk_
    complexed with cl, mes, mgm, zn

Details for d1tnbd_

PDB Entry: 1tnb (more details), 2.85 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a substrate kksktkcvif peptide derived from tc21
PDB Compounds: (D:) Geranylgeranyl transferase type I beta subunit

SCOPe Domain Sequences for d1tnbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnbd_ a.102.4.3 (D:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOPe Domain Coordinates for d1tnbd_ are not available.

Timeline for d1tnbd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tnba_, d1tnbb_, d1tnbc_, d1tnbe_, d1tnbf_, d1tnbg_, d1tnbh_, d1tnbi_, d1tnbj_, d1tnbk_, d1tnbl_