SCOPe 2.01: Domain d1tn8b_: 1tn8 B:

Lineage for d1tn8b_ (1tn8 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69090] (19 PDB entries)
   Uniprot P49356

8. Domain d1tn8b_: 1tn8 B: [112532]
   Other proteins in same PDB: d1tn8a_
   complexed with acy, fii, zn

Details for d1tn8b_

PDB Entry: 1tn8, 2.25 Å

PDB Description: Protein Farnesyltransferase Complexed with a H-Ras Peptide Substrate and a FPP Analog at 2.25A Resolution

PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d1tn8b_:

Sequence; same for both SEQRES and ATOM records:

>d1tn8b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d1tn8b_:

• d1tn8b_ first appeared in SCOP 1.71
  
• d1tn8b_ appears in SCOP 1.75
  
• d1tn8b_ appears in SCOPe 2.02
  
• d1tn8b_ appears in the current release, SCOPe 2.08