SCOPe 2.08: Domain d1tn7b_: 1tn7 B:

Lineage for d1tn7b_ (1tn7 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
   Uniprot Q02293 22-418 P53610

8. Domain d1tn7b_: 1tn7 B: [112530]
   Other proteins in same PDB: d1tn7a_
   complexed with acy, fii, zn

Details for d1tn7b_

PDB Entry: 1tn7, 2.3 Å

PDB Description: Protein Farnesyltransferase Complexed with a TC21 Peptide Substrate and a FPP Analog at 2.3A Resolution

PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d1tn7b_:

Sequence; same for both SEQRES and ATOM records:

>d1tn7b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d1tn7b_:

• d1tn7b_ first appeared in SCOP 1.71
  
• d1tn7b_ appears in SCOPe 2.07