Lineage for d1tn6a_ (1tn6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007074Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2007075Family a.118.6.1: Protein prenylyltransferase [48440] (3 protein domains)
  6. 2007076Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2007077Species Human (Homo sapiens) [TaxId:9606] [69093] (13 PDB entries)
    Uniprot P49354
  8. 2007081Domain d1tn6a_: 1tn6 A: [112527]
    Other proteins in same PDB: d1tn6b_
    complexed with acy, fii, suc, zn

Details for d1tn6a_

PDB Entry: 1tn6 (more details), 1.8 Å

PDB Description: Protein Farnesyltransferase Complexed with a Rap2a Peptide Substrate and a FPP Analog at 1.8A Resolution
PDB Compounds: (A:) protein farnesyltransferase alpha subunit

SCOPe Domain Sequences for d1tn6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tn6a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}
fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhst

SCOPe Domain Coordinates for d1tn6a_:

Click to download the PDB-style file with coordinates for d1tn6a_.
(The format of our PDB-style files is described here.)

Timeline for d1tn6a_: