Lineage for d1tn5b_ (1tn5 B:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745038Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 745039Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families) (S)
  5. 745040Family f.13.1.1: Bacteriorhodopsin-like [81319] (5 proteins)
  6. 745045Protein Bacteriorhodopsin [56871] (2 species)
    a light-driven proton pump
  7. 745050Species Archaeon Halobacterium salinarum [TaxId:2242] [56873] (60 PDB entries)
  8. 745099Domain d1tn5b_: 1tn5 B: [112526]
    complexed with ret; mutant

Details for d1tn5b_

PDB Entry: 1tn5 (more details), 2.2 Å

PDB Description: structure of bacterorhodopsin mutant k41p
PDB Compounds: (B:) bacteriorhodopsin

SCOP Domain Sequences for d1tn5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tn5b_ f.13.1.1 (B:) Bacteriorhodopsin {Archaeon Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakpfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

SCOP Domain Coordinates for d1tn5b_:

Click to download the PDB-style file with coordinates for d1tn5b_.
(The format of our PDB-style files is described here.)

Timeline for d1tn5b_: