SCOP 1.71: Domain d1tn5b_: 1tn5 B:

Lineage for d1tn5b_ (1tn5 B:)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (5 proteins)

6. Protein Bacteriorhodopsin [56871] (2 species)
   a light-driven proton pump

7. Species Archaeon Halobacterium salinarum [TaxId:2242] [56873] (54 PDB entries)

8. Domain d1tn5b_: 1tn5 B: [112526]
   complexed with ret; mutant

Details for d1tn5b_

PDB Entry: 1tn5, 2.2 Å

PDB Description: structure of bacterorhodopsin mutant k41p

SCOP Domain Sequences for d1tn5b_:

Sequence; same for both SEQRES and ATOM records:

>d1tn5b_ f.13.1.1 (B:) Bacteriorhodopsin {Archaeon Halobacterium salinarum}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakpfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

Timeline for d1tn5b_:

• d1tn5b_ is new in SCOP 1.71
  
• d1tn5b_ appears in SCOP 1.73
  
• d1tn5b_ appears in the current release, SCOPe 2.08