![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
![]() | Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) ![]() Pfam PF13853. Phylogeny described in PubMed 12761335 |
![]() | Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins) |
![]() | Protein Bacteriorhodopsin [56871] (3 species) a light-driven proton pump |
![]() | Species Halobacterium salinarum [TaxId:2242] [56873] (118 PDB entries) Uniprot P02945 17-245 |
![]() | Domain d1tn5b_: 1tn5 B: [112526] complexed with ret; mutant |
PDB Entry: 1tn5 (more details), 2.2 Å
SCOPe Domain Sequences for d1tn5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tn5b_ f.13.1.1 (B:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]} tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakpfyaittlvpaiaftmylsmllgy gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg
Timeline for d1tn5b_: