Lineage for d1tn5a_ (1tn5 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628564Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2628565Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2628566Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 2628571Protein Bacteriorhodopsin [56871] (3 species)
    a light-driven proton pump
  7. 2628576Species Halobacterium salinarum [TaxId:2242] [56873] (116 PDB entries)
    Uniprot P02945 17-245
  8. 2628658Domain d1tn5a_: 1tn5 A: [112525]
    complexed with ret; mutant

Details for d1tn5a_

PDB Entry: 1tn5 (more details), 2.2 Å

PDB Description: structure of bacterorhodopsin mutant k41p
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d1tn5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tn5a_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakpfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

SCOPe Domain Coordinates for d1tn5a_:

Click to download the PDB-style file with coordinates for d1tn5a_.
(The format of our PDB-style files is described here.)

Timeline for d1tn5a_: