Lineage for d1tmgi_ (1tmg I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944763Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2944764Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2944765Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 2944766Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 2944767Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. 2944776Domain d1tmgi_: 1tmg I: [112522]
    Other proteins in same PDB: d1tmge1, d1tmge2
    complexed with 15p, 1pe, ca, cit, na; mutant

Details for d1tmgi_

PDB Entry: 1tmg (more details), 1.67 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59f mutant
PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1tmgi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmgi_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
mktewpelvgksveeakkvilqdkpaaqiivlpvgtivtfeyridrvrlfvdrldniaqv
prvg

SCOPe Domain Coordinates for d1tmgi_:

Click to download the PDB-style file with coordinates for d1tmgi_.
(The format of our PDB-style files is described here.)

Timeline for d1tmgi_: