Lineage for d1tm7i_ (1tm7 I:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601959Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 601960Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) (S)
  5. 601961Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)
  6. 601962Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 601963Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (19 PDB entries)
  8. 601967Domain d1tm7i_: 1tm7 I: [112519]
    Other proteins in same PDB: d1tm7e_
    complexed with 1pe, ca, cit, na; mutant

Details for d1tm7i_

PDB Entry: 1tm7 (more details), 1.59 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59y mutant

SCOP Domain Sequences for d1tm7i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tm7i_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare)}
mktewpelvgksveeakkvilqdkpaaqiivlpvgtivtyeyridrvrlfvdrldniaqv
prvg

SCOP Domain Coordinates for d1tm7i_:

Click to download the PDB-style file with coordinates for d1tm7i_.
(The format of our PDB-style files is described here.)

Timeline for d1tm7i_: