![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
![]() | Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) ![]() |
![]() | Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins) |
![]() | Protein Chymotrypsin inhibitor CI-2 [54658] (1 species) |
![]() | Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (19 PDB entries) |
![]() | Domain d1tm7i_: 1tm7 I: [112519] Other proteins in same PDB: d1tm7e_ complexed with 1pe, ca, cit, na; mutant |
PDB Entry: 1tm7 (more details), 1.59 Å
SCOP Domain Sequences for d1tm7i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tm7i_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare)} mktewpelvgksveeakkvilqdkpaaqiivlpvgtivtyeyridrvrlfvdrldniaqv prvg
Timeline for d1tm7i_: