Lineage for d1tm7i_ (1tm7 I:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. Domain d1tm7i_: 1tm7 I: [112519]
    Other proteins in same PDB: d1tm7e1, d1tm7e2
    complexed with 1pe, ca, cit, na; mutant

Details for d1tm7i_

PDB Entry: 1tm7 (more details), 1.59 Å

PDB Description: crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59y mutant
PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1tm7i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tm7i_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
mktewpelvgksveeakkvilqdkpaaqiivlpvgtivtyeyridrvrlfvdrldniaqv
prvg

SCOPe Domain Coordinates for d1tm7i_ are not available.

Timeline for d1tm7i_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tm7e1, d1tm7e2