SCOP 1.75: Domain d1tm4i_: 1tm4 I:

Lineage for d1tm4i_ (1tm4 I:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)

6. Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
   Uniprot Q40059 22-84

8. Domain d1tm4i_: 1tm4 I: [112514]
   Other proteins in same PDB: d1tm4e_
   complexed with 1pe, ca, cit, na; mutant

Details for d1tm4i_

PDB Entry: 1tm4, 1.7 Å

PDB Description: crystal structure of the complex of subtilsin bpn'with chymotrypsin inhibitor 2 m59g mutant

PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOP Domain Sequences for d1tm4i_:

Sequence; same for both SEQRES and ATOM records:

>d1tm4i_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
mktewpelvgksveeakkvilqdkpaaqiivlpvgtivtgeyridrvrlfvdrldniaqv
prvg

Timeline for d1tm4i_:

• d1tm4i_ first appeared in SCOP 1.71
  
• d1tm4i_ appears in SCOP 1.73
  
• d1tm4i_ appears in SCOPe 2.01
  
• d1tm4i_ appears in the current release, SCOPe 2.08