![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
![]() | Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) ![]() |
![]() | Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
![]() | Protein Chymotrypsin inhibitor CI-2 [54658] (1 species) |
![]() | Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries) Uniprot Q40059 22-84 |
![]() | Domain d1tm4i_: 1tm4 I: [112514] Other proteins in same PDB: d1tm4e_ complexed with 1pe, ca, cit, na; mutant |
PDB Entry: 1tm4 (more details), 1.7 Å
SCOPe Domain Sequences for d1tm4i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tm4i_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]} mktewpelvgksveeakkvilqdkpaaqiivlpvgtivtgeyridrvrlfvdrldniaqv prvg
Timeline for d1tm4i_: