Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.1: Subtilases [52744] (15 proteins) |
Protein Subtilisin [52745] (7 species) |
Species Bacillus amyloliquefaciens, Novo/BPN' [TaxId:1390] [52751] (56 PDB entries) Uniprot P00782 108-382 |
Domain d1tm1e1: 1tm1 E:1-275 [112509] Other proteins in same PDB: d1tm1e2, d1tm1i_ complexed with 1pe, ca, cit, na |
PDB Entry: 1tm1 (more details), 1.7 Å
SCOPe Domain Sequences for d1tm1e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tm1e1 c.41.1.1 (E:1-275) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]} aqsvpygvsqikapalhsqgytgsnvkvavidsgidsshpdlkvaggasmvpsetnpfqd nnshgthvagtvaalnnsigvlgvapsaslyavkvlgadgsgqyswiingiewaiannmd vinmslggpsgsaalkaavdkavasgvvvvaaagnegtsgssstvgypgkypsviavgav dssnqrasfssvgpeldvmapgvsiqstlpgnkygayngtsmasphvagaaalilskhpn wtntqvrsslentttklgdsfyygkglinvqaaaq
Timeline for d1tm1e1: